SCOP 1.71: Domain d1t3fb2: 1t3f B:119-219

Lineage for d1t3fb2 (1t3f B:119-219)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1t3fb2: 1t3f B:119-219 [112231]
   Other proteins in same PDB: d1t3fa1, d1t3fa2, d1t3fb1

Details for d1t3fb2

PDB Entry: 1t3f, 2 Å

PDB Description: three dimensional structure of a humanized anti-ifn-gamma fab (huzaf) in p21 21 21 space group

SCOP Domain Sequences for d1t3fb2:

Sequence; same for both SEQRES and ATOM records:

>d1t3fb2 b.1.1.2 (B:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Timeline for d1t3fb2:

• d1t3fb2 is new in SCOP 1.71
  
• d1t3fb2 appears in SCOP 1.73
  
• d1t3fb2 appears in the current release, SCOPe 2.08