Lineage for d1t17a_ (1t17 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733278Fold d.129: TBP-like [55944] (10 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 733462Superfamily d.129.3: Bet v1-like [55961] (7 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 733622Family d.129.3.6: oligoketide cyclase/dehydrase-like [118101] (2 proteins)
    Pfam PF03654
  6. 733623Protein Hypothetical protein CC1736 [118102] (1 species)
  7. 733624Species Caulobacter crescentus [TaxId:155892] [118103] (1 PDB entry)
  8. 733625Domain d1t17a_: 1t17 A: [112215]
    structural genomics target

Details for d1t17a_

PDB Entry: 1t17 (more details)

PDB Description: Solution Structure of the 18 kDa Protein CC1736 from Caulobacter crescentus: The Northeast Structural Genomics Consortium Target CcR19
PDB Compounds: (A:) conserved hypothetical protein

SCOP Domain Sequences for d1t17a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t17a_ d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter crescentus [TaxId: 155892]}
mhrhvvtkvlpytpdqlfelvgdvdaypkfvpwitgmrtwngrvdgavstvdaeaqvgfs
flrekfatrvrrdkdarsidvsllygpfkrlnngwrfmpegdatrvefviefafksalld
amlaanvdraagkliacfearaqqlhga

SCOP Domain Coordinates for d1t17a_:

Click to download the PDB-style file with coordinates for d1t17a_.
(The format of our PDB-style files is described here.)

Timeline for d1t17a_: