Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.129: TBP-like [55944] (10 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (7 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.6: oligoketide cyclase/dehydrase-like [118101] (2 proteins) Pfam PF03654 |
Protein Hypothetical protein CC1736 [118102] (1 species) |
Species Caulobacter crescentus [TaxId:155892] [118103] (1 PDB entry) |
Domain d1t17a_: 1t17 A: [112215] structural genomics target |
PDB Entry: 1t17 (more details)
SCOP Domain Sequences for d1t17a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t17a_ d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter crescentus [TaxId: 155892]} mhrhvvtkvlpytpdqlfelvgdvdaypkfvpwitgmrtwngrvdgavstvdaeaqvgfs flrekfatrvrrdkdarsidvsllygpfkrlnngwrfmpegdatrvefviefafksalld amlaanvdraagkliacfearaqqlhga
Timeline for d1t17a_: