Lineage for d1t0nd1 (1t0n D:182-278)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1759808Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1760095Species Mouse (Mus musculus) [TaxId:10090] [88606] (103 PDB entries)
    Uniprot P01901 22-299
  8. 1760106Domain d1t0nd1: 1t0n D:182-278 [112208]
    Other proteins in same PDB: d1t0na2, d1t0nb_, d1t0nd2, d1t0ne_

Details for d1t0nd1

PDB Entry: 1t0n (more details), 1.8 Å

PDB Description: conformational switch in polymorphic h-2k molecules containing an hsv peptide
PDB Compounds: (D:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1t0nd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0nd1 b.1.1.2 (D:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrweppp

SCOPe Domain Coordinates for d1t0nd1:

Click to download the PDB-style file with coordinates for d1t0nd1.
(The format of our PDB-style files is described here.)

Timeline for d1t0nd1: