Lineage for d1t0nb_ (1t0n B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2025134Protein beta2-microglobulin [88600] (6 species)
  7. 2025828Species Mouse (Mus musculus) [TaxId:10090] [88603] (182 PDB entries)
    Uniprot P01887
  8. 2025851Domain d1t0nb_: 1t0n B: [112207]
    Other proteins in same PDB: d1t0na1, d1t0na2, d1t0nd1, d1t0nd2

Details for d1t0nb_

PDB Entry: 1t0n (more details), 1.8 Å

PDB Description: conformational switch in polymorphic h-2k molecules containing an hsv peptide
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1t0nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0nb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1t0nb_:

Click to download the PDB-style file with coordinates for d1t0nb_.
(The format of our PDB-style files is described here.)

Timeline for d1t0nb_: