Lineage for d1t0me_ (1t0m E:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 931882Protein beta2-microglobulin [88600] (5 species)
  7. 932374Species Mouse (Mus musculus) [TaxId:10090] [88603] (142 PDB entries)
    Uniprot P01887
  8. 932426Domain d1t0me_: 1t0m E: [112204]
    Other proteins in same PDB: d1t0ma1, d1t0ma2, d1t0md1, d1t0md2

Details for d1t0me_

PDB Entry: 1t0m (more details), 2 Å

PDB Description: conformational switch in polymorphic h-2k molecules containing an hsv peptide
PDB Compounds: (E:) Beta-2-microglobulin

SCOPe Domain Sequences for d1t0me_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0me_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1t0me_:

Click to download the PDB-style file with coordinates for d1t0me_.
(The format of our PDB-style files is described here.)

Timeline for d1t0me_: