SCOP 1.73: Domain d1t04d2: 1t04 D:119-219

Lineage for d1t04d2 (1t04 D:119-219)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1t04d2: 1t04 D:119-219 [112189]
   Other proteins in same PDB: d1t04a1, d1t04a2, d1t04b1, d1t04c1, d1t04c2, d1t04d1

Details for d1t04d2

PDB Entry: 1t04, 3 Å

PDB Description: three dimensional structure of a humanized anti-ifn-gamma fab in c2 space group

PDB Compounds: (D:) Huzaf Antibody Heavy Chain

SCOP Domain Sequences for d1t04d2:

Sequence; same for both SEQRES and ATOM records:

>d1t04d2 b.1.1.2 (D:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Timeline for d1t04d2:

• d1t04d2 first appeared in SCOP 1.71
  
• d1t04d2 appears in SCOP 1.75
  
• d1t04d2 appears in the current release, SCOPe 2.08