| Class b: All beta proteins [48724] (149 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
| Domain d1t04b2: 1t04 B:119-219 [112185] Other proteins in same PDB: d1t04a1, d1t04a2, d1t04b1, d1t04c1, d1t04c2, d1t04d1 |
PDB Entry: 1t04 (more details), 3 Å
SCOP Domain Sequences for d1t04b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t04b2 b.1.1.2 (B:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
Timeline for d1t04b2: