Lineage for d1t04a1 (1t04 A:1-108)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2022563Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2022564Species Engineered (including hybrid species) [88533] (61 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 2022631Domain d1t04a1: 1t04 A:1-108 [112182]
    Other proteins in same PDB: d1t04a2, d1t04b1, d1t04b2, d1t04c2, d1t04d1, d1t04d2

Details for d1t04a1

PDB Entry: 1t04 (more details), 3 Å

PDB Description: three dimensional structure of a humanized anti-ifn-gamma fab in c2 space group
PDB Compounds: (A:) Huzaf Antibody Light Chain

SCOPe Domain Sequences for d1t04a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t04a1 b.1.1.1 (A:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspstlsasvgdrvtitckasenvdtyvswyqqkpgkapklliygasnrytgvps
rfsgsgsgtdftltisslqpddfatyycgqsynypftfgqgtkvevkr

SCOPe Domain Coordinates for d1t04a1:

Click to download the PDB-style file with coordinates for d1t04a1.
(The format of our PDB-style files is described here.)

Timeline for d1t04a1: