Lineage for d1szra1 (1szr A:37-43,A:284-408)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 955060Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 955167Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 955195Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 955212Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)
  7. 955218Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [50628] (5 PDB entries)
    Uniprot P07805
  8. 955227Domain d1szra1: 1szr A:37-43,A:284-408 [112174]
    Other proteins in same PDB: d1szra2, d1szrb2, d1szrc2, d1szrd2
    complexed with orx, plg, pxp; mutant

Details for d1szra1

PDB Entry: 1szr (more details), 2.15 Å

PDB Description: a dimer interface mutant of ornithine decarboxylase reveals structure of gem diamine intermediate
PDB Compounds: (A:) ornithine decarboxylase

SCOPe Domain Sequences for d1szra1:

Sequence, based on SEQRES records: (download)

>d1szra1 b.49.2.3 (A:37-43,A:284-408) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gdpffvaXftlavnviakavtpgvqtdvgahaesnaqsfmyyvndgvygsfncilydhav
vrplpqrepipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgts
sfngfqsptiyyv

Sequence, based on observed residues (ATOM records): (download)

>d1szra1 b.49.2.3 (A:37-43,A:284-408) Eukaryotic ornithine decarboxylase (ODC) {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gdpffvaXftlavnviakavtqsfmyyvndgvygsfncilydhavvrplpqrepipnekl
ypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyv

SCOPe Domain Coordinates for d1szra1:

Click to download the PDB-style file with coordinates for d1szra1.
(The format of our PDB-style files is described here.)

Timeline for d1szra1: