Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (11 families) |
Family d.2.1.3: Phage lysozyme [53981] (3 proteins) |
Protein Phage T4 lysozyme [53982] (1 species) |
Species Bacteriophage T4 [TaxId:10665] [53983] (446 PDB entries) Uniprot P00720 many mutant structures |
Domain d1sx2a_: 1sx2 A: [112139] complexed with bme, cl, rb; mutant |
PDB Entry: 1sx2 (more details), 1.06 Å
SCOP Domain Sequences for d1sx2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sx2a_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]} mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk deaeklfnqdvaaavrgilrnaklkpvydsldavrecalinmvfqmgetgvagftnslrm lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
Timeline for d1sx2a_: