Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (28 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein Papillomavirus large T antigen helicase domain [89688] (1 species) |
Species Simian virus 40 [TaxId:10633] [89689] (5 PDB entries) Uniprot P03070 265-627 |
Domain d1svmc_: 1svm C: [112128] |
PDB Entry: 1svm (more details), 1.94 Å
SCOP Domain Sequences for d1svmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1svmc_ c.37.1.20 (C:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} tkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyana aifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadi eewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcg gkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgs vkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclersefll ekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgig vld
Timeline for d1svmc_: