SCOP 1.73: Domain d1svlb_: 1svl B:

Lineage for d1svlb_ (1svl B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (27 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Papillomavirus large T antigen helicase domain [89688] (1 species)

7. Species Simian virus 40 [TaxId:10633] [89689] (5 PDB entries)

8. Domain d1svlb_: 1svl B: [112124]

Details for d1svlb_

PDB Entry: 1svl, 1.95 Å

PDB Description: Co-crystal structure of SV40 large T antigen helicase domain and ADP

PDB Compounds: (B:) large t antigen

SCOP Domain Sequences for d1svlb_:

Sequence; same for both SEQRES and ATOM records:

>d1svlb_ c.37.1.20 (B:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}
kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
ld

Timeline for d1svlb_:

• d1svlb_ first appeared in SCOP 1.71
  
• d1svlb_ appears in SCOP 1.75
  
• d1svlb_ appears in the current release, SCOPe 2.08