SCOPe 2.04: Domain d1sjpb2: 1sjp B:189-372

Lineage for d1sjpb2 (1sjp B:189-372)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)

6. Protein GroEL, A domain [52031] (4 species)

7. Species Mycobacterium tuberculosis, GroEL2 [TaxId:1773] [117456] (1 PDB entry)
   Uniprot P0A520 60-514

8. Domain d1sjpb2: 1sjp B:189-372 [112096]
   Other proteins in same PDB: d1sjpa1, d1sjpa3, d1sjpb1, d1sjpb3

Details for d1sjpb2

PDB Entry: 1sjp, 3.2 Å

PDB Description: Mycobacterium tuberculosis Chaperonin60.2

PDB Compounds: (B:) 60 kDa chaperonin 2

SCOPe Domain Sequences for d1sjpb2:

Sequence; same for both SEQRES and ATOM records:

>d1sjpb2 c.8.5.1 (B:189-372) GroEL, A domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]}
gmrfdkgyisgyfvtdperqeavledpyillvsskvstvkdllpllekvigagkplliia
edvegealstlvvnkirgtfksvavkapgfgdrrkamlqdmailtggqviseevgltlen
adlsllgkarkvvvtkdettivegagdtdaiagrvaqirqeiensdsdydreklqerlak
lagg

Timeline for d1sjpb2:

• d1sjpb2 first appeared in SCOP 1.71
  
• d1sjpb2 appears in SCOPe 2.03
  
• d1sjpb2 appears in SCOPe 2.05
  
• d1sjpb2 appears in the current release, SCOPe 2.08