Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) |
Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins) |
Protein GroEL, A domain [52031] (4 species) |
Species Mycobacterium tuberculosis, GroEL2 [TaxId:1773] [117456] (1 PDB entry) Uniprot P0A520 60-514 |
Domain d1sjpa2: 1sjp A:189-372 [112093] Other proteins in same PDB: d1sjpa1, d1sjpa3, d1sjpb1, d1sjpb3 |
PDB Entry: 1sjp (more details), 3.2 Å
SCOPe Domain Sequences for d1sjpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjpa2 c.8.5.1 (A:189-372) GroEL, A domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} gmrfdkgyisgyfvtdperqeavledpyillvsskvstvkdllpllekvigagkplliia edvegealstlvvnkirgtfksvavkapgfgdrrkamlqdmailtggqviseevgltlen adlsllgkarkvvvtkdettivegagdtdaiagrvaqirqeiensdsdydreklqerlak lagg
Timeline for d1sjpa2: