SCOP 1.71: Domain d1sb3b2: 1sb3 B:1-216

Lineage for d1sb3b2 (1sb3 B:1-216)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.145: FAD-binding domain [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding domain [56176] (3 families)

5. Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (5 proteins)

6. Protein 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, N-terminal domain [118141] (1 species)

7. Species Thauera aromatica [TaxId:59405] [118142] (2 PDB entries)

8. Domain d1sb3b2: 1sb3 B:1-216 [112055]
   Other proteins in same PDB: d1sb3a1, d1sb3a2, d1sb3b1, d1sb3c1, d1sb3c2, d1sb3d1, d1sb3d2, d1sb3e1, d1sb3f1, d1sb3f2

Details for d1sb3b2

PDB Entry: 1sb3, 2.2 Å

PDB Description: Structure of 4-hydroxybenzoyl-CoA reductase from Thauera aromatica

SCOP Domain Sequences for d1sb3b2:

Sequence; same for both SEQRES and ATOM records:

>d1sb3b2 d.145.1.3 (B:1-216) 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, N-terminal domain {Thauera aromatica}
mniltdfrthrpatladavnalaaeatlplgagtdllpnlrrglghpaalvdltgidgla
tistladgslrigagatleaiaehdairttwpalaqaaesvagpthraaatlggnlcqdt
rctfynqsewwrsgngyclkykgdkchvivksdrcyatyhgdvapalmvldaraeivgpa
gkrtvpvaqlfresgaehltlekgellaaievpptg

Timeline for d1sb3b2:

• d1sb3b2 is new in SCOP 1.71
  
• d1sb3b2 appears in SCOP 1.73
  
• d1sb3b2 appears in the current release, SCOPe 2.08