![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein Hepatocyte nuclear factor 6 [116780] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [116781] (1 PDB entry) Uniprot O08755 291-437 |
![]() | Domain d1s7ea1: 1s7e A:103-152 [112044] Other proteins in same PDB: d1s7ea2 |
PDB Entry: 1s7e (more details)
SCOPe Domain Sequences for d1s7ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} prlvftdvqrrtlhaifkenkrpskelqitisqqlglelstvsnffmnar
Timeline for d1s7ea1: