SCOP 1.71: Domain d1s7ea1: 1s7e A:103-152

Lineage for d1s7ea1 (1s7e A:103-152)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (13 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (28 proteins)
   Pfam 00046

6. Protein Hepatocyte nuclear factor 6 [116780] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [116781] (1 PDB entry)

8. Domain d1s7ea1: 1s7e A:103-152 [112044]
   Other proteins in same PDB: d1s7ea2

Details for d1s7ea1

PDB Entry: 1s7e

PDB Description: solution structure of hnf-6

SCOP Domain Sequences for d1s7ea1:

Sequence; same for both SEQRES and ATOM records:

>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus)}
prlvftdvqrrtlhaifkenkrpskelqitisqqlglelstvsnffmnar

Timeline for d1s7ea1:

• d1s7ea1 is new in SCOP 1.71
  
• d1s7ea1 appears in SCOP 1.73
  
• d1s7ea1 appears in the current release, SCOPe 2.08