SCOPe 2.02: Domain d1s4ma2: 1s4m A:1-158

Lineage for d1s4ma2 (1s4m A:1-158)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein FMN adenylyltransferase domain of bifunctional FAD synthetase [102260] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [102261] (6 PDB entries)
   Uniprot Q9WZW1
   TM0379

8. Domain d1s4ma2: 1s4m A:1-158 [112024]
   Other proteins in same PDB: d1s4ma1, d1s4mb1
   complexed with lum, mg

Details for d1s4ma2

PDB Entry: 1s4m, 2.1 Å

PDB Description: crystal structure of flavin binding to fad synthetase from thermotoga maritina

PDB Compounds: (A:) Riboflavin kinase/FMN adenylyltransferase

SCOPe Domain Sequences for d1s4ma2:

Sequence; same for both SEQRES and ATOM records:

>d1s4ma2 c.26.1.3 (A:1-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]}
mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv
emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv
evyeiedvvvqgkrvssslirnlvqegrveeipaylgr

Timeline for d1s4ma2:

• d1s4ma2 first appeared in SCOP 1.71
  
• d1s4ma2 appears in SCOPe 2.01
  
• d1s4ma2 appears in SCOPe 2.03
  
• d1s4ma2 appears in the current release, SCOPe 2.08