Lineage for d1rzry_ (1rzr Y:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 868636Fold d.94: HPr-like [55593] (2 superfamilies)
    beta-alpha-beta(2)-alpha-beta-alpha; 2 layers: a/b; antiparallel sheet 1423
  4. 868637Superfamily d.94.1: HPr-like [55594] (1 family) (S)
  5. 868638Family d.94.1.1: HPr-like [55595] (2 proteins)
  6. 868655Protein Histidine-containing phosphocarrier protein (HPr) [55596] (7 species)
  7. 868656Species Bacillus megaterium [TaxId:1404] [118054] (4 PDB entries)
    Uniprot O69250
  8. 868661Domain d1rzry_: 1rzr Y: [112000]
    Other proteins in same PDB: d1rzra1, d1rzra2, d1rzrc1, d1rzrc2, d1rzrd1, d1rzrd2, d1rzrg1, d1rzrg2
    complexed with mg, so4

Details for d1rzry_

PDB Entry: 1rzr (more details), 2.8 Å

PDB Description: crystal structure of transcriptional regulator-phosphoprotein-DNA complex
PDB Compounds: (Y:) Phosphocarrier protein HPr

SCOP Domain Sequences for d1rzry_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rzry_ d.94.1.1 (Y:) Histidine-containing phosphocarrier protein (HPr) {Bacillus megaterium [TaxId: 1404]}
aqktftvtadsgiharpattlvqaaskfdsdinlefngktvnlksimgvmslgiqkgati
tisaegsdeadalaaledtmskeglge

SCOP Domain Coordinates for d1rzry_:

Click to download the PDB-style file with coordinates for d1rzry_.
(The format of our PDB-style files is described here.)

Timeline for d1rzry_: