Lineage for d1rs0a2 (1rs0 A:243-452)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892202Protein Complement factor B domain [102541] (1 species)
  7. 2892203Species Human (Homo sapiens) [TaxId:9606] [102542] (5 PDB entries)
    Uniprot P00751 268-764
  8. 2892208Domain d1rs0a2: 1rs0 A:243-452 [111931]
    Other proteins in same PDB: d1rs0a1
    complexed with dfp, iod, mg, na

Details for d1rs0a2

PDB Entry: 1rs0 (more details), 2.6 Å

PDB Description: crystal structure analysis of the bb segment of factor b complexed with di-isopropyl-phosphate (dip)
PDB Compounds: (A:) complement factor b

SCOPe Domain Sequences for d1rs0a2:

Sequence, based on SEQRES records: (download)

>d1rs0a2 c.62.1.1 (A:243-452) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]}
smniylvldgsdsigasnftgakkvlvnliekvasygvkpryglvtyatypkiwvkvsea
dssnadwvtkqlneinyedhklksgtntkkalqavysmmswpddvppegwnrtrhviilm
tdglhnmggdpitvideirdllyigkdrknpredyldvyvfgvgplvnqvninalaskkd
neqhvckvkdmecledvfyqmidesqslsl

Sequence, based on observed residues (ATOM records): (download)

>d1rs0a2 c.62.1.1 (A:243-452) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]}
smniylvldgsdsigasnftgakkvlvnliekvasygvkpryglvtyatypkiwvkvsea
dssnadwvtkqlneinyedhklksgtntkkalqavysmmswpgwnrtrhviilmtdglhn
mggdpitvideirdllyigkdrnpredyldvyvfgvgplvnqvninalaskkdneqhvck
vkdmecledvfyqmidesqslsl

SCOPe Domain Coordinates for d1rs0a2:

Click to download the PDB-style file with coordinates for d1rs0a2.
(The format of our PDB-style files is described here.)

Timeline for d1rs0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rs0a1