Lineage for d1rq9b_ (1rq9 B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562942Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 562943Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 562944Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 562960Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 562961Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (179 PDB entries)
  8. 563308Domain d1rq9b_: 1rq9 B: [111909]
    complexed with 450; mutant

Details for d1rq9b_

PDB Entry: 1rq9 (more details), 2.6 Å

PDB Description: Crystal structures of a Multidrug-Resistant HIV-1 Protease Reveal an Expanded Active Site Cavity

SCOP Domain Sequences for d1rq9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rq9b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrpivtikiggqlkeallntgaddtvleevnlpgrwkpkliggiggfvkvrqyd
qvpieicghkvigtvlvgptpanvigrnlmtqigctlnf

SCOP Domain Coordinates for d1rq9b_:

Click to download the PDB-style file with coordinates for d1rq9b_.
(The format of our PDB-style files is described here.)

Timeline for d1rq9b_: