SCOP 1.73: Domain d1ro9b_: 1ro9 B:

Lineage for d1ro9b_ (1ro9 B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families)

5. Family a.211.1.2: PDEase [48548] (6 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48550] (14 PDB entries)

8. Domain d1ro9b_: 1ro9 B: [111900]
   complexed with 8br, zn; mutant

Details for d1ro9b_

PDB Entry: 1ro9, 2.13 Å

PDB Description: crystal structures of the catalytic domain of phosphodiesterase 4b2b complexed with 8-br-amp

PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOP Domain Sequences for d1ro9b_:

Sequence; same for both SEQRES and ATOM records:

>d1ro9b_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
hplwetwadlvqpdaqdildtlednrnwyqsmipqap

Timeline for d1ro9b_:

• d1ro9b_ first appeared in SCOP 1.71
  
• d1ro9b_ appears in SCOP 1.75
  
• d1ro9b_ appears in the current release, SCOPe 2.08