SCOP 1.71: Domain d1rmwb_: 1rmw B:

Lineage for d1rmwb_ (1rmw B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (18 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.12: Class B acid phosphatase [102307] (1 protein)
   the insertion subdomain is a helical hairpin

6. Protein Class B acid phosphatase [102308] (1 species)

7. Species Escherichia coli [TaxId:562] [102309] (7 PDB entries)

8. Domain d1rmwb_: 1rmw B: [111893]
   complexed with adn, mg, po4

Details for d1rmwb_

PDB Entry: 1rmw, 1.25 Å

PDB Description: Crystal structure of AphA class B acid phosphatase/phosphotransferase ternary complex with adenosine and phosphate bound to the catalytic metal at 1.2 A resolution

SCOP Domain Sequences for d1rmwb_:

Sequence; same for both SEQRES and ATOM records:

>d1rmwb_ c.108.1.12 (B:) Class B acid phosphatase {Escherichia coli}
spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
girilrasnstykplpqagafgeevivnsey

Timeline for d1rmwb_:

• d1rmwb_ is new in SCOP 1.71
  
• d1rmwb_ does not appear in SCOP 1.73