Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (174 PDB entries) Uniprot P01887 |
Domain d1rjye_: 1rjy E: [111841] Other proteins in same PDB: d1rjya1, d1rjya2, d1rjyd1, d1rjyd2 mutant |
PDB Entry: 1rjy (more details), 1.9 Å
SCOPe Domain Sequences for d1rjye_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rjye_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1rjye_: