| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
| Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries) Uniprot P01901 22-299 |
| Domain d1rjyd2: 1rjy D:1-181 [111840] Other proteins in same PDB: d1rjya1, d1rjyb_, d1rjyd1, d1rjye_ mutant |
PDB Entry: 1rjy (more details), 1.9 Å
SCOPe Domain Sequences for d1rjyd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rjyd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r
Timeline for d1rjyd2:
View in 3DDomains from other chains: (mouse over for more information) d1rjya1, d1rjya2, d1rjyb_, d1rjye_ |