Lineage for d1rjyb_ (1rjy B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1105903Protein beta2-microglobulin [88600] (5 species)
  7. 1106406Species Mouse (Mus musculus) [TaxId:10090] [88603] (150 PDB entries)
    Uniprot P01887
  8. 1106448Domain d1rjyb_: 1rjy B: [111838]
    Other proteins in same PDB: d1rjya1, d1rjya2, d1rjyd1, d1rjyd2
    mutant

Details for d1rjyb_

PDB Entry: 1rjy (more details), 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1rjyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjyb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1rjyb_:

Click to download the PDB-style file with coordinates for d1rjyb_.
(The format of our PDB-style files is described here.)

Timeline for d1rjyb_: