SCOP 1.71: Domain d1rjyb_: 1rjy B:

Lineage for d1rjyb_ (1rjy B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (66 PDB entries)

8. Domain d1rjyb_: 1rjy B: [111838]
   Other proteins in same PDB: d1rjya1, d1rjya2, d1rjyd1, d1rjyd2

Details for d1rjyb_

PDB Entry: 1rjy, 1.9 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide

SCOP Domain Sequences for d1rjyb_:

Sequence; same for both SEQRES and ATOM records:

>d1rjyb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus)}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1rjyb_:

• d1rjyb_ is new in SCOP 1.71
  
• d1rjyb_ appears in SCOP 1.73
  
• d1rjyb_ appears in the current release, SCOPe 2.08, called d1rjyb1