SCOPe 2.08: Domain d1rjla1: 1rjl A:1-107

Lineage for d1rjla1 (1rjl A:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (60 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody

8. Domain d1rjla1: 1rjl A:1-107 [111821]
   Other proteins in same PDB: d1rjla2, d1rjlb1, d1rjlb2, d1rjlb3, d1rjlc_
   MQ NA P01837 # artificial chimera

Details for d1rjla1

PDB Entry: 1rjl, 2.6 Å

PDB Description: Structure of the complex between OspB-CT and bactericidal Fab-H6831

PDB Compounds: (A:) Fab H6831 L-chain

SCOPe Domain Sequences for d1rjla1:

Sequence; same for both SEQRES and ATOM records:

>d1rjla1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmnqspsslsaslgdtititchasqninvwlnwfqqkpgsipklliymasnlhtgvps
rfsgsgsgtgftltisslqpediatyycqqgqsfpltfgggtkleik

Timeline for d1rjla1:

• d1rjla1 first appeared in SCOP 1.71
  
• d1rjla1 appears in SCOPe 2.07