SCOPe 2.07: Domain d1rgq.1: 1rgq A:,D:

Lineage for d1rgq.1 (1rgq A:,D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein NS3 protease [50600] (5 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (14 PDB entries)
   Uniprot P27958 1027-1206,1678-1669
   Uniprot P26662 1029-1202,1677-1689
   Uniprot O36579 1054-1207

8. Domain d1rgq.1: 1rgq A:,D: [111803]
   complexed with akp, zn

Details for d1rgq.1

PDB Entry: 1rgq, 2.9 Å

PDB Description: M9A HCV Protease complex with pentapeptide keto-amide inhibitor

PDB Compounds: (A:) NS3 protease, (D:) ns4a peptide

SCOPe Domain Sequences for d1rgq.1:

Sequence; same for both SEQRES and ATOM records:

>g1rgq.1 b.47.1.3 (A:,D:) NS3 protease {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
qvegevqivstatqtflatcingvcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpa
pqgsrsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpa
ghavglfraavctrgvtkavdfipvenlettmrsXgsvvivgrivlsgkpai

Timeline for d1rgq.1:

• d1rgq.1 first appeared in SCOP 1.71
  
• d1rgq.1 appears in SCOPe 2.06
  
• d1rgq.1 appears in the current release, SCOPe 2.08