SCOPe 2.01: Domain d1ra4a_: 1ra4 A:

Lineage for d1ra4a_ (1ra4 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Ribosomal protein L7ae [55319] (7 species)

7. Species Methanococcus jannaschii [TaxId:2190] [111033] (3 PDB entries)
   Uniprot P54066

8. Domain d1ra4a_: 1ra4 A: [111758]

Details for d1ra4a_

PDB Entry: 1ra4, 1.86 Å

PDB Description: Crystal structure of the Methanococcus jannaschii L7Ae protein

PDB Compounds: (A:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d1ra4a_:

Sequence; same for both SEQRES and ATOM records:

>d1ra4a_ d.79.3.1 (A:) Ribosomal protein L7ae {Methanococcus jannaschii [TaxId: 2190]}
mavyvkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvah
lpylceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlkq

Timeline for d1ra4a_:

• d1ra4a_ first appeared in SCOP 1.71
  
• d1ra4a_ appears in SCOP 1.75
  
• d1ra4a_ appears in SCOPe 2.02
  
• d1ra4a_ appears in the current release, SCOPe 2.08