Lineage for d1r9jb3 (1r9j B:527-669)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 834846Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 834847Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 834848Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 834867Protein Transketolase (TK), C-domain [52924] (4 species)
    two N-terminal domains are PP and Pyr modules of thiamin-binding fold
  7. 834892Species Leishmania mexicana mexicana [TaxId:44270] [117610] (1 PDB entry)
    Uniprot Q8MPM3
  8. 834894Domain d1r9jb3: 1r9j B:527-669 [111727]
    Other proteins in same PDB: d1r9ja1, d1r9ja2, d1r9jb1, d1r9jb2
    complexed with ca, tpp

Details for d1r9jb3

PDB Entry: 1r9j (more details), 2.22 Å

PDB Description: Transketolase from Leishmania mexicana
PDB Compounds: (B:) transketolase

SCOP Domain Sequences for d1r9jb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9jb3 c.48.1.1 (B:527-669) Transketolase (TK), C-domain {Leishmania mexicana mexicana [TaxId: 44270]}
ssiegvrhgaysvvdvpdlqlvivasgsevslavdaakalsgelrvrvvsmpcqelfdaq
pdtyrqavlpagvpvvsveayvsfgwekyshahvgmsgfgasapagvlykkfgitveevv
rtgrelakrfpdgtaplknssfs

SCOP Domain Coordinates for d1r9jb3:

Click to download the PDB-style file with coordinates for d1r9jb3.
(The format of our PDB-style files is described here.)

Timeline for d1r9jb3: