| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.10: TK-like PP module [88760] (2 proteins) different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain |
| Protein Transketolase (TK), PP module [88761] (4 species) |
| Species Leishmania mexicana mexicana [TaxId:44270] [117524] (1 PDB entry) |
| Domain d1r9jb2: 1r9j B:1-336 [111726] Other proteins in same PDB: d1r9ja1, d1r9ja3, d1r9jb1, d1r9jb3 complexed with ca, tpp |
PDB Entry: 1r9j (more details), 2.22 Å
SCOP Domain Sequences for d1r9jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r9jb2 c.36.1.10 (B:1-336) Transketolase (TK), PP module {Leishmania mexicana mexicana}
masiekvancirclaadivqggksghpgtpmgmapmsavlwtevmkynsqdpdwvdrdrf
vmsnghgcalqyallhmagynltmddlkgfrqdgsrtpghperfvtpgvevttgplgqgi
anavglaiaeahlaatfnrpgynivdhytyvycgdgclmegvcqealslaghlalekliv
iydsnyisidgstslsfteqchqkyvamgfhvievkngdtdyeglrkalaeakatkgkpk
mivqtttigfgsskqgtekvhgaplgeedianikakfgrdpqkkydvdddvravfrmhid
kcsaeqkaweellakytaafpaegaafvaqmrgelp
Timeline for d1r9jb2: