SCOP 1.75: Domain d1r9jb1: 1r9j B:337-526

Lineage for d1r9jb1 (1r9j B:337-526)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.6: TK-like Pyr module [88735] (2 proteins)
   different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain

6. Protein Transketolase (TK), Pyr module [88736] (4 species)

7. Species Leishmania mexicana mexicana [TaxId:44270] [117521] (1 PDB entry)
   Uniprot Q8MPM3

8. Domain d1r9jb1: 1r9j B:337-526 [111725]
   Other proteins in same PDB: d1r9ja2, d1r9ja3, d1r9jb2, d1r9jb3
   complexed with ca, tpp

Details for d1r9jb1

PDB Entry: 1r9j, 2.22 Å

PDB Description: Transketolase from Leishmania mexicana

PDB Compounds: (B:) transketolase

SCOP Domain Sequences for d1r9jb1:

Sequence; same for both SEQRES and ATOM records:

>d1r9jb1 c.36.1.6 (B:337-526) Transketolase (TK), Pyr module {Leishmania mexicana mexicana [TaxId: 44270]}
sgweaklptnssaiatrkasenclavlfpaipalmggsadltpsnltrpasanlvdfsss
skegryirfgvrehamcailngldahdgiipfggtflnfigyalgavrlaaishhrviyv
athdsigvgedgpthqpvelvaalrampnlqvirpsdqtetsgawavalssihtptvlcl
srqntepqsg

Timeline for d1r9jb1:

• d1r9jb1 first appeared in SCOP 1.71
  
• d1r9jb1 appears in SCOP 1.73
  
• d1r9jb1 appears in SCOPe 2.01
  
• d1r9jb1 appears in the current release, SCOPe 2.08