Lineage for d1r9ja2 (1r9j A:1-336)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1361462Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1361463Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1361892Family c.36.1.10: TK-like PP module [88760] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 1361911Protein Transketolase (TK), PP module [88761] (4 species)
  7. 1361936Species Leishmania mexicana mexicana [TaxId:44270] [117524] (1 PDB entry)
    Uniprot Q8MPM3
  8. 1361937Domain d1r9ja2: 1r9j A:1-336 [111723]
    Other proteins in same PDB: d1r9ja1, d1r9ja3, d1r9jb1, d1r9jb3
    complexed with ca, tpp

Details for d1r9ja2

PDB Entry: 1r9j (more details), 2.22 Å

PDB Description: Transketolase from Leishmania mexicana
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d1r9ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r9ja2 c.36.1.10 (A:1-336) Transketolase (TK), PP module {Leishmania mexicana mexicana [TaxId: 44270]}
masiekvancirclaadivqggksghpgtpmgmapmsavlwtevmkynsqdpdwvdrdrf
vmsnghgcalqyallhmagynltmddlkgfrqdgsrtpghperfvtpgvevttgplgqgi
anavglaiaeahlaatfnrpgynivdhytyvycgdgclmegvcqealslaghlalekliv
iydsnyisidgstslsfteqchqkyvamgfhvievkngdtdyeglrkalaeakatkgkpk
mivqtttigfgsskqgtekvhgaplgeedianikakfgrdpqkkydvdddvravfrmhid
kcsaeqkaweellakytaafpaegaafvaqmrgelp

SCOPe Domain Coordinates for d1r9ja2:

Click to download the PDB-style file with coordinates for d1r9ja2.
(The format of our PDB-style files is described here.)

Timeline for d1r9ja2: