SCOP 1.75: Domain d1q6za1: 1q6z A:182-341

Lineage for d1q6za1 (1q6z A:182-341)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
   N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold

6. Protein Benzoylformate decarboxylase [52482] (1 species)

7. Species Pseudomonas putida [TaxId:303] [52483] (9 PDB entries)
   Uniprot P20906

8. Domain d1q6za1: 1q6z A:182-341 [111655]
   Other proteins in same PDB: d1q6za2, d1q6za3
   complexed with ca, mg, tdp; mutant

Details for d1q6za1

PDB Entry: 1q6z, 1 Å

PDB Description: high resolution structure of e28a mutant benzoylformate decarboxylase from pseudomonas putida complexed with thiamin thiazolone diphosphate

PDB Compounds: (A:) Benzoylformate decarboxylase

SCOP Domain Sequences for d1q6za1:

Sequence; same for both SEQRES and ATOM records:

>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap

Timeline for d1q6za1:

• d1q6za1 first appeared in SCOP 1.71
  
• d1q6za1 appears in SCOP 1.73
  
• d1q6za1 appears in SCOPe 2.01
  
• d1q6za1 appears in the current release, SCOPe 2.08