Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein TEV protease (nucleat inclusion protein A, NIA) [82126] (1 species) |
Species Tobacco etch virus, TEV [TaxId:12227] [82127] (3 PDB entries) Uniprot P04517 2041-2279 |
Domain d1q31a_: 1q31 A: [111650] complexed with bme; mutant |
PDB Entry: 1q31 (more details), 2.7 Å
SCOPe Domain Sequences for d1q31a_:
Sequence, based on SEQRES records: (download)
>d1q31a_ b.47.1.3 (A:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} lfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhgv fkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksmss mvsdtsctfpssdgifwkhwiqtkdgqagsplvstrdgfivgihsasnftntnnyftsvp knfmelltnqeaqqwvsgwrlnadsvlwgghkvfmskpeepfqpvkeatqlmnelvysq
>d1q31a_ b.47.1.3 (A:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} lfkgprdynpisstichltnesdghttslygigfgpfiitnkhlfrrnngtllvqslhgv fkvkntttlqqhlidgrdmiiirmpkdfppfpqklkfrepqreericlvttnfqtksmss mvsdtsctfpssdgifwkhwiqtkdgqagsplvstrdgfivgihsasnftntnnyftsvp knfmelltnqeaqqwvsgwrlnadsvlwgghkvfmskpemnelvysq
Timeline for d1q31a_: