Lineage for d1oeca_ (1oec A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611837Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 611838Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 611879Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 612199Protein Fibroblast growth factor receptor 2 [75562] (1 species)
    PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase
  7. 612200Species Human (Homo sapiens) [TaxId:9606] [75563] (2 PDB entries)
  8. 612201Domain d1oeca_: 1oec A: [111630]
    complexed with aa2, so4

Details for d1oeca_

PDB Entry: 1oec (more details), 2.4 Å

PDB Description: fgfr2 kinase domain

SCOP Domain Sequences for d1oeca_:

Sequence, based on SEQRES records: (download)

>d1oeca_ d.144.1.7 (A:) Fibroblast growth factor receptor 2 {Human (Homo sapiens)}
elpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavkmlkddatek
dlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmey
sydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfg
lardinnidyykkttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypg
ipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltltt

Sequence, based on observed residues (ATOM records): (download)

>d1oeca_ d.144.1.7 (A:) Fibroblast growth factor receptor 2 {Human (Homo sapiens)}
elpedpkwefprdkltlgkplgegcfgqvvmaeavgikpkeavtvavkmlkddatekdls
dlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarreqmtfkdlv
sctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidyykkttngr
lpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkeghrmdk
panctnelymmmrdcwhavpsqrptfkqlvedldriltltt

SCOP Domain Coordinates for d1oeca_:

Click to download the PDB-style file with coordinates for d1oeca_.
(The format of our PDB-style files is described here.)

Timeline for d1oeca_: