SCOP 1.71: Domain d1h48f_: 1h48 F:

Lineage for d1h48f_ (1h48 F:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (1 family)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (2 proteins)

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (4 species)

7. Species Escherichia coli [TaxId:562] [69768] (10 PDB entries)

8. Domain d1h48f_: 1h48 F: [111626]
   complexed with c5p, cdi, gpp, mn, zn

Details for d1h48f_

PDB Entry: 1h48, 2.3 Å

PDB Description: the structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase in complex with cmp and product

SCOP Domain Sequences for d1h48f_:

Sequence; same for both SEQRES and ATOM records:

>d1h48f_ d.79.5.1 (F:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Escherichia coli}
lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
dlgchmddvnvkattteklgftgrgegiaceavallika

Timeline for d1h48f_:

• d1h48f_ is new in SCOP 1.71
  
• d1h48f_ appears in SCOP 1.73
  
• d1h48f_ appears in the current release, SCOPe 2.08, called d1h48f1