Lineage for d1s722_ (1s72 2:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1099677Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1099678Superfamily a.137.1: Ribosomal protein L39e [48662] (1 family) (S)
    interrupted alpha-helix
  5. 1099679Family a.137.1.1: Ribosomal protein L39e [48663] (1 protein)
  6. 1099680Protein Ribosomal protein L39e [48664] (1 species)
  7. 1099681Species Haloarcula marismortui [TaxId:2238] [48665] (58 PDB entries)
    Uniprot P22452
  8. 1099687Domain d1s722_: 1s72 2: [111599]
    Other proteins in same PDB: d1s721_, d1s723_, d1s72a1, d1s72a2, d1s72b_, d1s72c_, d1s72d_, d1s72e1, d1s72e2, d1s72f_, d1s72g_, d1s72h_, d1s72i_, d1s72j_, d1s72k_, d1s72l_, d1s72m_, d1s72n_, d1s72o_, d1s72p_, d1s72q_, d1s72r_, d1s72s_, d1s72t_, d1s72u_, d1s72v_, d1s72w_, d1s72x_, d1s72y_, d1s72z_
    complexed with cd, cl, k, mg, na

Details for d1s722_

PDB Entry: 1s72 (more details), 2.4 Å

PDB Description: refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
PDB Compounds: (2:) 50S ribosomal protein L39e

SCOPe Domain Sequences for d1s722_:

Sequence, based on SEQRES records: (download)

>d1s722_ a.137.1.1 (2:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde

Sequence, based on observed residues (ATOM records): (download)

>d1s722_ a.137.1.1 (2:) Ribosomal protein L39e {Haloarcula marismortui [TaxId: 2238]}
gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde

SCOPe Domain Coordinates for d1s722_:

Click to download the PDB-style file with coordinates for d1s722_.
(The format of our PDB-style files is described here.)

Timeline for d1s722_: