SCOP 1.71: Domain d1q46a1: 1q46 A:89-175

Lineage for d1q46a1 (1q46 A:89-175)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.60: SAM domain-like [47768] (14 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.14: eIF2alpha middle domain-like [116742] (1 family)

5. Family a.60.14.1: eIF2alpha middle domain-like [116743] (1 protein)

6. Protein Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 [116744] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [116746] (1 PDB entry)

8. Domain d1q46a1: 1q46 A:89-175 [111594]
   Other proteins in same PDB: d1q46a2

Details for d1q46a1

PDB Entry: 1q46, 2.86 Å

PDB Description: crystal structure of the eIF2 alpha subunit from saccharomyces cerevisia

SCOP Domain Sequences for d1q46a1:

Sequence; same for both SEQRES and ATOM records:

>d1q46a1 a.60.14.1 (A:89-175) Eukaryotic initiation factor 2alpha, eIF2alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae)}
vssediikceekyqksktvhsilrycaekfqipleelyktiawplsrkfghayeafklsi
idetvwegieppskdvldelknyiskr

Timeline for d1q46a1:

• d1q46a1 is new in SCOP 1.71
  
• d1q46a1 appears in SCOP 1.73
  
• d1q46a1 appears in the current release, SCOPe 2.08