SCOPe 2.02: Domain d1g38d2: 1g38 D:244-413

Lineage for d1g38d2 (1g38 D:244-413)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
   comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin

4. Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families)

5. Family d.287.1.1: TaqI C-terminal domain-like [116735] (1 protein)

6. Protein DNA methylase TaqI, C-terminal domain [116736] (1 species)

7. Species Thermus aquaticus [TaxId:271] [116737] (12 PDB entries)

8. Domain d1g38d2: 1g38 D:244-413 [111570]
   Other proteins in same PDB: d1g38a1, d1g38d1
   protein/DNA complex; complexed with nea

Details for d1g38d2

PDB Entry: 1g38, 2 Å

PDB Description: adenine-specific methyltransferase m. taq i/dna complex

PDB Compounds: (D:) modification methylase taqi

SCOPe Domain Sequences for d1g38d2:

Sequence; same for both SEQRES and ATOM records:

>d1g38d2 d.287.1.1 (D:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]}
rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv
dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg
vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht

Timeline for d1g38d2:

• d1g38d2 first appeared in SCOP 1.71
  
• d1g38d2 appears in SCOPe 2.01
  
• d1g38d2 appears in SCOPe 2.03
  
• d1g38d2 appears in the current release, SCOPe 2.08