Lineage for d1aqjb2 (1aqj B:244-413)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1448375Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
    comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin
  4. 1448376Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) (S)
  5. 1448377Family d.287.1.1: TaqI C-terminal domain-like [116735] (1 protein)
  6. 1448378Protein DNA methylase TaqI, C-terminal domain [116736] (1 species)
  7. 1448379Species Thermus aquaticus [TaxId:271] [116737] (12 PDB entries)
  8. 1448397Domain d1aqjb2: 1aqj B:244-413 [111566]
    Other proteins in same PDB: d1aqja1, d1aqjb1
    complexed with sfg

Details for d1aqjb2

PDB Entry: 1aqj (more details), 2.6 Å

PDB Description: structure of adenine-n6-dna-methyltransferase taqi
PDB Compounds: (B:) adenine-n6-DNA-methyltransferase taqi

SCOPe Domain Sequences for d1aqjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqjb2 d.287.1.1 (B:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]}
rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv
dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg
vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht

SCOPe Domain Coordinates for d1aqjb2:

Click to download the PDB-style file with coordinates for d1aqjb2.
(The format of our PDB-style files is described here.)

Timeline for d1aqjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aqjb1