SCOP 1.71: Domain d1x86g1: 1x86 G:766-994

Lineage for d1x86g1 (1x86 G:766-994)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
   multihelical; core: 5-helical bundle

4. Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (1 family)

5. Family a.87.1.1: DBL homology domain (DH-domain) [48066] (9 proteins)
   Pfam 00621

6. Protein Rho guanine nucleotide exchange factor 12 [109937] (1 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [109938] (2 PDB entries)

8. Domain d1x86g1: 1x86 G:766-994 [109513]
   Other proteins in same PDB: d1x86a2, d1x86b_, d1x86c2, d1x86d_, d1x86e2, d1x86f_, d1x86g2, d1x86h_
   complexed with po4; mutant

Details for d1x86g1

PDB Entry: 1x86, 3.22 Å

PDB Description: crystal structure of the dh/ph domains of leukemia-associated rhogef in complex with rhoa

SCOP Domain Sequences for d1x86g1:

Sequence; same for both SEQRES and ATOM records:

>d1x86g1 a.87.1.1 (G:766-994) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform}
ppnwqqlvsrevllglkpceikrqevinelfyterahvrtlkvldqvfyqrvsregilsp
selrkifsnledilqlhiglneqmkavrkrnetsvidqigedlltwfsgpgeeklkhaaa
tfcsnqpfalemiksrqkkdsrfqtfvqdaesnplcrrlqlkdiiptqmqrltkypllld
niakytewpterekvkkaadhcrqilnfvnqavkeaenkqrledyqrrl

Timeline for d1x86g1:

• d1x86g1 first appeared in SCOP 1.69
  
• d1x86g1 appears in SCOP 1.73
  
• d1x86g1 appears in the current release, SCOPe 2.08