Lineage for d1x86c1 (1x86 C:766-999)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445734Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 445735Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (1 family) (S)
  5. 445736Family a.87.1.1: DBL homology domain (DH-domain) [48066] (8 proteins)
    Pfam 00621
  6. 445764Protein Rho guanine nucleotide exchange factor 12 [109937] (1 species)
  7. 445765Species Human (Homo sapiens), gamma isoform [TaxId:9606] [109938] (2 PDB entries)
  8. 445768Domain d1x86c1: 1x86 C:766-999 [109507]
    Other proteins in same PDB: d1x86a2, d1x86b_, d1x86c2, d1x86d_, d1x86e2, d1x86f_, d1x86g2, d1x86h_

Details for d1x86c1

PDB Entry: 1x86 (more details), 3.22 Å

PDB Description: crystal structure of the dh/ph domains of leukemia-associated rhogef in complex with rhoa

SCOP Domain Sequences for d1x86c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x86c1 a.87.1.1 (C:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform}
ppnwqqlvsrevllglkpceikrqevinelfyterahvrtlkvldqvfyqrvsregilsp
selrkifsnledilqlhiglneqmkavrkrnetsvidqigedlltwfsgpgeeklkhaaa
tfcsnqpfalemiksrqkkdsrfqtfvqdaesnplcrrlqlkdiiptqmqrltkypllld
niakytewpterekvkkaadhcrqilnfvnqavkeaenkqrledyqrrldtssl

SCOP Domain Coordinates for d1x86c1:

Click to download the PDB-style file with coordinates for d1x86c1.
(The format of our PDB-style files is described here.)

Timeline for d1x86c1: