Lineage for d1x86b_ (1x86 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582287Protein RhoA [52612] (1 species)
  7. 582288Species Human (Homo sapiens) [TaxId:9606] [52613] (12 PDB entries)
  8. 582304Domain d1x86b_: 1x86 B: [109506]
    Other proteins in same PDB: d1x86a1, d1x86a2, d1x86c1, d1x86c2, d1x86e1, d1x86e2, d1x86g1, d1x86g2

Details for d1x86b_

PDB Entry: 1x86 (more details), 3.22 Å

PDB Description: crystal structure of the dh/ph domains of leukemia-associated rhogef in complex with rhoa

SCOP Domain Sequences for d1x86b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x86b_ c.37.1.8 (B:) RhoA {Human (Homo sapiens)}
aairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdta
gqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdl
rndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa

SCOP Domain Coordinates for d1x86b_:

Click to download the PDB-style file with coordinates for d1x86b_.
(The format of our PDB-style files is described here.)

Timeline for d1x86b_: