SCOPe 2.08: Domain d1woqb2: 1woq B:140-263

Lineage for d1woqb2 (1woq B:140-263)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.10: ROK [110636] (8 proteins)
   Pfam PF00480

6. Protein Inorganic polyphosphate/ATP-glucomannokinase PPGMK [110637] (1 species)

7. Species Arthrobacter sp. KM [TaxId:184230] [110638] (1 PDB entry)
   Uniprot Q7WT42 11-263 # Fragment

8. Domain d1woqb2: 1woq B:140-263 [109465]
   complexed with bgc, po4

Details for d1woqb2

PDB Entry: 1woq, 1.8 Å

PDB Description: crystal structure of inorganic polyphosphate/atp-glucomannokinase from arthrobacter sp. strain km at 1.8 a resolution

PDB Compounds: (B:) Inorganic polyphosphate/ATP-glucomannokinase

SCOPe Domain Sequences for d1woqb2:

Sequence; same for both SEQRES and ATOM records:

>d1woqb2 c.55.1.10 (B:140-263) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]}
vkgtvlvitlgtgigsafifdgklvpnaelghleidghdaetkasavarerdglswdeys
vllqryfshveflfspelfivgggiskradeylpnlrlrtpivpavlrneagivgaaiei
alqh

Timeline for d1woqb2:

• d1woqb2 first appeared in SCOP 1.69
  
• d1woqb2 appears in SCOPe 2.07