Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (23 species) |
Species Aldabra giant tortoise (Geochelone gigantea) [TaxId:167804] [100976] (3 PDB entries) Uniprot P83134 |
Domain d1wmua_: 1wmu A: [109416] Other proteins in same PDB: d1wmub_ complexed with hem |
PDB Entry: 1wmu (more details), 1.65 Å
SCOPe Domain Sequences for d1wmua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wmua_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Aldabra giant tortoise (Geochelone gigantea) [TaxId: 167804]} mlteddkqliqhvwekvlehqedfgaealermfivypstktyfphfdlhhdseqirhhgk kvvgalgdavkhidnlsatlselsnlhaynlrvdpvnfkllshcfqvvlgahlgreytpq vqvaydkflaavsavlaekyr
Timeline for d1wmua_: