Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab9a [110537] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [110539] (1 PDB entry) Uniprot P51151 2-175 # 100% sequence identity do the dog protein (Uniprot P24408 2-175) |
Domain d1wmsb_: 1wms B: [109415] complexed with gdp |
PDB Entry: 1wms (more details), 1.25 Å
SCOPe Domain Sequences for d1wmsb_:
Sequence, based on SEQRES records: (download)
>d1wmsb_ c.37.1.8 (B:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} sslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtmqiwdta gqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvilgn kidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlat
>d1wmsb_ c.37.1.8 (B:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} sslfkvillgdggvgksslmnryvtnkfdttigveflnkdlevdghfvtmqiwdtagqer frslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadesfpfvilgnkidiserq vsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlat
Timeline for d1wmsb_: