SCOP 1.71: Domain d1wmsa_: 1wms A:

Lineage for d1wmsa_ (1wms A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab9a [110537] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110539] (1 PDB entry)

8. Domain d1wmsa_: 1wms A: [109414]

Details for d1wmsa_

PDB Entry: 1wms, 1.25 Å

PDB Description: High resolution crystal structure of human Rab9 GTPase: a novel antiviral drug target

SCOP Domain Sequences for d1wmsa_:

Sequence, based on SEQRES records:

>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens)}
agksslfkvillgdggvgksslmnryvtnkfdtqlfhtigveflnkdlevdghfvtmqiw
dtagqerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvi
lgnkidiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlat

Sequence, based on observed residues (ATOM records):

>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens)}
agksslfkvillgdggvgksslmnryvtnkfdttigveflnkdlevdghfvtmqiwdtag
qerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvilgnk
idiserqvsteeaqawcrdngdypyfetsakdatnvaaafeeavrrvlat

Timeline for d1wmsa_:

• d1wmsa_ first appeared in SCOP 1.69
  
• d1wmsa_ appears in SCOP 1.73
  
• d1wmsa_ appears in the current release, SCOPe 2.08