Lineage for d1wlqf_ (1wlq F:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 533238Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) (S)
    contains a small beta-sheet (wing)
  5. 533889Family a.4.5.52: DNA replication factor Cdt1 [109686] (1 protein)
  6. 533890Protein DNA replication factor Cdt1 [109687] (1 species)
  7. 533891Species Mouse (Mus musculus) [TaxId:10090] [109688] (1 PDB entry)
  8. 533893Domain d1wlqf_: 1wlq F: [109403]
    Other proteins in same PDB: d1wlqa_, d1wlqb_, d1wlqd_, d1wlqe_

Details for d1wlqf_

PDB Entry: 1wlq (more details), 2.8 Å

PDB Description: Strucure of Geminin-Cdt1 complex

SCOP Domain Sequences for d1wlqf_:

Sequence, based on SEQRES records: (download)

>d1wlqf_ a.4.5.52 (F:) DNA replication factor Cdt1 {Mouse (Mus musculus)}
kapayqrfhalaqpglpglvlpykyqvlvemfhsmdtivsmlhnrsetvtfakvkqgvqe
mmrkrfeernvgqiktvypmsyrfrqecnvptfkdsikrsdyqltiepllgqeaggatql
tatcllqrrqvfrqnlvervkeqhkvflaslnppmavpddqltrwhprfnvdevpdiepa
elpqppv

Sequence, based on observed residues (ATOM records): (download)

>d1wlqf_ a.4.5.52 (F:) DNA replication factor Cdt1 {Mouse (Mus musculus)}
kapayqrfhalaqpglpglvlpykyqvlvemfhsmdtivsmlhnrsetvtfakvkqgvqe
mmrkrfeernvgqiktvypmsyrfrqecnvptfkdsikrsdyqltiepllgqeatqltat
cllqrrqvfrqnlvervkeqhkvflaslnppmavpddqltrwhprfnvdevpdiepaelp
qppv

SCOP Domain Coordinates for d1wlqf_:

Click to download the PDB-style file with coordinates for d1wlqf_.
(The format of our PDB-style files is described here.)

Timeline for d1wlqf_: